luisgarcia38461 luisgarcia38461

07-06-2017
English

contestada

One way to punctuate a compound sentence correctly is to join the two independent clauses with

Respuesta :

CodyCoyote CodyCoyote

07-06-2017

You join two independent clauses with one dependent clause.

Answer Link

smartjazmin9 smartjazmin9

29-09-2021

Answer:

a semicolon and a coordinating conjunction.

Explanation:

Got it right on my test

Answer Link

Otras preguntas

Five more than four times a number

How environmental conditions influence modern history? Plz it’s 7th grade science

what 13x75x3x56-1= what

Felix bought x pounds of grapes that cost $1.25 per pound and y boxes of cereal that cost $2.50 per box. He spent less than $10. Which graph represents this sce

Which answer choice represents an equivalent number sentence that uses the associative property to rewrite "[(-4) + (-3)] +-5"? A. -7 + -5 B. -4 + [(-3) + (-5)]

Find the value of X.

Which of these is an example of a tariff? Amazon charges $5 for same day delivery McDonalds adds $ .50 to the price of a cheeseburger Racine County Government r

Hi does anyone wanna do a math homework assignment? it involves volume and algebra (I'm in alg2/trig)

A 2 kg object is moving at a constant velocity of 15 m/s. What is its acceleration?

The oligopeptide MNQSYGRLVSRAAIAATAMASLIKIFAWWY was cleaved by reaction with trypsin. Trypsin is a serine protease that hydrolyses peptide chains at the protein